PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.3G222700.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 486aa    MW: 54372.7 Da    PI: 7.9328
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.3G222700.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.31.1e-102331648
                        HHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding 16 vkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        vk++G++ W++Iar +  gR +kqc++rw+++l
  Sevir.3G222700.2.p  2 VKKYGPKKWSLIARSLD-GRIGKQCRERWHNHL 33
                        9****************.*************97 PP

2Myb_DNA-binding543.9e-173982146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                        + +W+ eE+   +da++++G++ W+ Ia+ ++ gRt++++k++w++
  Sevir.3G222700.2.p 39 KEAWSVEEERVVADAHRLHGNK-WAEIAKLLP-GRTDNSIKNHWNS 82
                        579*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.199133IPR017930Myb domain
CDDcd001674.63E-9133No hitNo description
SMARTSM007170.39135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.8E-18140IPR009057Homeodomain-like
PfamPF002491.7E-8233IPR001005SANT/Myb domain
SuperFamilySSF466894.21E-261292IPR009057Homeodomain-like
PROSITE profilePS5129424.5363488IPR017930Myb domain
SMARTSM007177.0E-153886IPR001005SANT/Myb domain
PfamPF002492.7E-153982IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.8E-214188IPR009057Homeodomain-like
CDDcd001678.09E-124184No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 486 aa     Download sequence    Send to blast
MVKKYGPKKW SLIARSLDGR IGKQCRERWH NHLDPQIIKE AWSVEEERVV ADAHRLHGNK  60
WAEIAKLLPG RTDNSIKNHW NSSLRKRLGD YNASRALPVS VHMVHNSFKH EKAKLSGGNH  120
IDLNKEPNIN LERPPEIVDH SEHATHLHAC SLKNIKSCSD FLSLAMPTAQ PKKLCEMFGG  180
GYSAVALAGI QGLKMDFVHD KGTEINVVCK ERLKNDLLNV EVRKLDHATD TIGYSGSAKV  240
EGKTVNNMCK LFLPNESNSF GSLCYEIPKL EDVVPCHSPV FSTPHIQQCC EDGFLPPVGY  300
TTSSRDGDIS DQLSVESILK SAAENFPGTP SILRRRKRET PAHDEDSNLK IAILHSNSFH  360
TPLGKCTTES PHSFKTASFL SLGPPDNEGL SATLGSFDVS PPYRLRSKRM AILKTVEKKH  420
LNFSSDEMDN YDSPDTMKKY SSWKTECTNT YTDVSSKQEM KMTEHMVDLE TLAKDFTHTT  480
KLDLI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C9e-4118818105C-Myb DNA-Binding Domain
1mse_C9e-4118818105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961857.10.0PREDICTED: myb-related protein A-like
RefseqXP_014660295.10.0PREDICTED: myb-related protein A-like
TrEMBLK3Z4L60.0K3Z4L6_SETIT; Uncharacterized protein
STRINGSi021484m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-44myb domain protein 3r-5